Filetype
Concurrent testing of the cores in a modular core-based System-on-Chip reduces the test application time but increases the test power consumption. Power models and scheduling algorithms have been proposed to schedule the tests as concurrently as possible while respecting the power budget. The commonly used global peak power model, with a single value capturing the power dissipated by a core when t
A non-associated plasticity theory for granular materials has been developed in Part 1 based on the concept of a characteristic stress state of vanishing incremental dilation. The model is fully three-dimensional and is defined by six material parameters: two for elastic stiffness, one for plastic stiffness, two for the shapes of yield and plastic potential surfaces and one for the dilation at fai
Quantification of platelet-bound immunoglobulin is widely used in the evaluation of thrombocytopenia. Several methods have been devised among which labelled ligand-binding assays seem to be most appropriate. In series of adult patients such assays have been shown to be superior in separating immune-thrombocytopenia from thrombocytopenia of non-immune causes. We studied 62 children with thrombocyto
The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka
The PHENIX On-Line system takes signals from the Front End Modules (FEM) on each detector subsystem for the purpose of generating events for physics analysis. Processing of event data begins when the Data Collection Modules (DCM) receive data via fiber-optic links from the FEMs. The DCMs format and zero suppress the data and generate data packets. These packets go to the Event Builders (EvB) that
Lying athwart both the temperate and subtropical zones, the Ning-Zhen Mountains are particularly prone to extreme floods in the summer months when cold fronts collide with the subtropics-derived warm airmasses. The Holocene flood deposits in the region may provide a long-term perspective on hydrographical change and its palaeoclimatic implications. Radiocarbon dates on carbonised wood preserved in
Binding properties of staphylococcal protein A (SpA) to different human immunoglobulins have been investigated. In this analysis, intact SpA as well as SpA-derived fragments containing one to five IgG-binding domains of different compositions, were used. The affinity binding constants of the different proteins to human polyclonal IgG, IgA, IgM and F(ab')2-fragments as well as their binding capacit
The light response of a BGO crystal has been measured for particles Z = 1-8, A = 1-16 in the energy range similar to2-60 A MeV. The reaction products are identified by a DeltaE(Si) - E(Sci/PD) telescope, The position of the jump in the value of the signal from the PD at the punch-through points is used to calibrate both the DeltaE(Si) and E(Sci/PD) scales in MeV. The dependence of the light output
Genome-wide association studies have recently identified at least 15 susceptibility loci for systemic lupus erythematosus (SLE). To confirm additional risk loci, we selected SNPs from 2,466 regions that showed nominal evidence of association to SLE (P < 0.05) in a genome-wide study and genotyped them in an independent sample of 1,963 cases and 4,329 controls. This replication effort identified fiv
Objective: Lewy-related pathology is the characteristic feature of Parkinson's disease with and without dementia and dementia with Lewy bodies (DLB). There are two neuropathological staging systems for Lewy-related pathology commonly employed today: the staging system for Parkinson-related pathology by Braak et al., and the staging system by the Consortium on DLB. There are also several modified s
The majority of motorcycle accident fatalities in Malaysia occur on primary roads, especially at access points situated along straight road sections. To explore the behavioral factors that may contribute to motorcyclists being involved in hazardous situations at these locations and to develop working hypotheses for a consecutive quantitative study, a qualitative observational study was carried out
Obesity is a major global public health problem, and understanding its pathogenesis is critical for identifying a cure. In this study, a gene knockout strategy was used in post-neonatal mice to delete synoviolin (Syvn) 1/Hrd1/Der3, an ER-resident E3 ubiquitin ligase with known roles in homeostasis maintenance. Syvn1 deficiency resulted in weight loss and lower accumulation of white adipose tissue
Wass, M., Ibertsson, T., Lyxell, B., Sahlen, B., Hallgren, M., Larsby, B. & Maki-Torkko, E. (2008). Cognitive and linguistic skills in Swedish children with cochlear implants - measures of accuracy and latency as indicators of development. Scandinavian Journal of Psychology. The purpose of the present study was to examine working memory (WM) capacity, lexical access and phonological skills in
The fillet of the gear tooth is highly stressed in operation; so for heavily loaded gears, the fillet geometry must be controlled. The manufacturer's task is to, within acceptable tolerances, produce the gear to the designer's specifications regardless of the manufacturing method. Most often gear cutting tools are used that work under generating conditions. The tool will form the gear tooth; so to
Rural depopulation is a concern in many countries, and various policy initiatives have been taken to combat such trends. This article examines whether hidden potential for rural population growth can be found in Sweden. If such potential exists, it implies that the development prospects for many rural areas are not as unpromising as they may seem today. If not, rapid rural depopulation can be expe
The main purpose of this research is to provide an agenda for future warehousing research relevant for both academic development and practitioners’ needs. In order to suggest a practically relevant future research agenda, first a comprehensive literature review was performed to identify research areas covered in the literature. Then, 15 warehouse managers and senior consultants were interviewed to
