Search results

OBJECTIVE: To compare the outcome following Lichtenstein open mesh technique or Shouldice repair for inguinal hernia operated on by surgeons in training. DESIGN: Prospective, randomised, trial. SETTING: District hospital, Sweden. SUBJECTS: 200 men with primary inguinal hernias. INTERVENTIONS: Lichtenstein mesh repair or Shouldice repair. MAIN OUTCOME MEASURES: Duration of operation, postoperative

Concurrent testing of the cores in a modular core-based System-on-Chip reduces the test application time but increases the test power consumption. Power models and scheduling algorithms have been proposed to schedule the tests as concurrently as possible while respecting the power budget. The commonly used global peak power model, with a single value capturing the power dissipated by a core when t

A non-associated plasticity theory for granular materials has been developed in Part 1 based on the concept of a characteristic stress state of vanishing incremental dilation. The model is fully three-dimensional and is defined by six material parameters: two for elastic stiffness, one for plastic stiffness, two for the shapes of yield and plastic potential surfaces and one for the dilation at fai

Quantification of platelet-bound immunoglobulin is widely used in the evaluation of thrombocytopenia. Several methods have been devised among which labelled ligand-binding assays seem to be most appropriate. In series of adult patients such assays have been shown to be superior in separating immune-thrombocytopenia from thrombocytopenia of non-immune causes. We studied 62 children with thrombocyto

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka

The PHENIX On-Line system takes signals from the Front End Modules (FEM) on each detector subsystem for the purpose of generating events for physics analysis. Processing of event data begins when the Data Collection Modules (DCM) receive data via fiber-optic links from the FEMs. The DCMs format and zero suppress the data and generate data packets. These packets go to the Event Builders (EvB) that

Lying athwart both the temperate and subtropical zones, the Ning-Zhen Mountains are particularly prone to extreme floods in the summer months when cold fronts collide with the subtropics-derived warm airmasses. The Holocene flood deposits in the region may provide a long-term perspective on hydrographical change and its palaeoclimatic implications. Radiocarbon dates on carbonised wood preserved in

Binding properties of staphylococcal protein A (SpA) to different human immunoglobulins have been investigated. In this analysis, intact SpA as well as SpA-derived fragments containing one to five IgG-binding domains of different compositions, were used. The affinity binding constants of the different proteins to human polyclonal IgG, IgA, IgM and F(ab')2-fragments as well as their binding capacit

The light response of a BGO crystal has been measured for particles Z = 1-8, A = 1-16 in the energy range similar to2-60 A MeV. The reaction products are identified by a DeltaE(Si) - E(Sci/PD) telescope, The position of the jump in the value of the signal from the PD at the punch-through points is used to calibrate both the DeltaE(Si) and E(Sci/PD) scales in MeV. The dependence of the light output

In this paper we introduce two new methods for solving binary quadratic problems. While spectral relaxation methods have been the workhorse subroutine for a wide variety of computer vision problems - segmentation, clustering, image restoration to name a few - it has recently been challenged by semidefinite programming (SDP) relaxations. In fact, it can be shown that SDP relaxations produce better

Popular Abstract in Swedish Många material som ingår i tillverkade varor har kvar sina kvaliteter även när varorna är uttjänta. Men bara en liten del av dessa material återvinns idag på ett sätt som gör det möjligt att återanvända materialet för samma syfte och med bevarade egenskaper. I allmänhet har det industriella samhället fortsatt att praktisera en slit- och slängmentalitet, trots att det beMany anthropogenically-produced or beneficiated materials contained in “end-of-life” products retain a great proportion of the invested manufacturing work when discarded. Very few such materials are reconstituted and applied in new products at the same material inherent quality level as in their first lifetime – a process known as “closed-loop recycling”. In general, industrial society maintains a

Popular Abstract in Swedish Målsättningen med avhandlingen är att analysera vilken roll småskaligt entreprenörskap som alternativ överlevnadsstrategi har spelat i Sierra Leone under den ekonomiska kris som drabbade landet efter självständighet på 1960-talet. Avhandlingen baseras på nätverksteori, snowball metod och det empiriska underlaget utgörs av en studie av utvecklingen i Sierra Leone, med avSierra Leone is a small country with rich mineral resources such as diamonds, bauxite, gold and iron ore. Other resources include fishing, forestry and fertile agricultural land, which enable people to farm without any sophisticated methods of mechanization. Nevertheless, with all its wealth in resources, the country is relatively poor and is one of the least developed countries in the Sub-Saharan