Filtyp
The hospital morbidity and mortality of 100 patients operated with two internal thoracic arteries with or without additional vein grafts (BITA group) were compared with a matched group of 100 patients operated with one left internal thoracic artery (ITA) on the anterior descending artery with additional vein grafts (LITA control group). In each study group, 3% of the patients had diabetes mellitus
Anion exchange membrane water electrolysis (AEMWE) is a potentially low-cost and sustainable technology for hydrogen production that combines the advantages of proton exchange membrane water electrolysis and traditional alkaline water electrolysis systems. Despite considerable research efforts in recent years, the medium-term (100 h) stability of AemionTM membranes needs further investigation. Thi
The effects of peptidolysis during early cheese ripening were studied in a low-fat (10% fat), round-eyed, semi-hard cheese using gel permeation chromatography and determinations of N content in cheese extracts. Addition of a heat-treated culture of Lactobacillus helveticus enhanced the peptidolytic activity even during the first weeks of cheese ripening. An aminopeptidase was found to have the nec
Histidine is a key amino-acid residue in proteins with unique properties engendered by its imidazole side chain that can exist in three different states: two different neutral tautomeric forms and a protonated, positively charged one with a pKa value close to physiological pH. Commonly, two or all three states coexist and interchange rapidly, enabling histidine to act as both donor and acceptor of
We provide a comparative analysis of qualitative features of different numerical methods for the inhomogeneous geometric Brownian motion (IGBM). The limit distribution of the IGBM exists, its conditional and asymptotic mean and variance are known and the process can be characterised according to Feller's boundary classification. We compare the frequently used Euler–Maruyama and Milstein methods, t
Protected area networks help species respond to climate warming. However, the contribution of a site's environmental and conservation-relevant characteristics to these responses is not well understood. We investigated how composition of nonbreeding waterbird communities (97 species) in the European Union Natura 2000 (N2K) network (3018 sites) changed in response to increases in temperature over 25
This dissertation explores the interplay between valuation and academic socialization, addressing the question: how do early career academics navigate evaluative landscapes? Having completed their doctoral education but yet to find stable employment, early career academics are generally viewed as the most vulnerable group of academic staff. Comparing how individuals within this group seek to demonThis dissertation explores the interplay between valuation and academic socialization, addressing the question: how do early career academics navigate evaluative landscapes? Having completed their doctoral education but yet to find stable employment, early career academics are generally viewed as the most vulnerable group of academic staff. Comparing how individuals within this group seek to demon
DOCTORAL DISSERTATIONDoctoral dissertation for the degree of Doctor of Philosophy (PhD) at the Faculties of Humanities and Theology at Lund University to be publicly defended on the 14th of February at 13.00 in room LUX:B336, Lund University Cognitive Science, Helgonavägen 3, LundFaculty opponent:Professor Dr. Claudia Männel, LeipzigIn the present thesis, brainwaves analyzed as event-related poten
Transportation noise is a ubiquitous urban exposure. In 2018, the World Health Organization concluded that chronic exposure to road traffic noise is a risk factor for ischemic heart disease. In contrast, they concluded that the quality of evidence for a link to other diseases was very low to moderate. Since then, several studies on the impact of noise on various diseases have been published. Also,
Gout is a chronic disease that is caused by an innate immune response to deposited monosodium urate crystals in the setting of hyperuricemia. Here, we provide insights into the molecular mechanism of the poorly understood inflammatory component of gout from a genome-wide association study (GWAS) of 2.6 million people, including 120,295 people with prevalent gout. We detected 377 loci and 410 genet
OBJECTIVE: The Bath Ankylosing Spondylitis Disease Activity Index (BASDAI) is widely used for assessing disease activity in patients with axial spondyloarthritis (axSpA), particularly in settings where markers of inflammation are unavailable. As no consensus on BASDAI cut-off values exists for disease activity states in axSpA, we aimed to develop and validate such cut-offs against external criteri
We present a web-based method for mapping various relations between agents that have been involved in an emergency response operation. The method is based on combining a web-questionnaire with telephone interviews and it provides an efficient way of collecting large amount of information concerning the agents. By using the resulting network of agents it is possible to perform various network analy
We have formulated and investigated innovative lipid-based nanoparticles characterized by a reverse hexagonal liquid crystalline inner structure (hexosomes). These nanoparticles were doped with a potent, highly water insoluble anticancer drug, namely docetaxel, and stabilized by a mixture of commercial and folate- and rhodamine-conjugated Pluronic F108. Thus, they simultaneously possess therapeuti
Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieve
The present study examined the capability of a real-time assessment routine to sort out the individual impact of three production systems on psychological activation as measured by the Stress/Energy Inventory, Karolinska Sleepiness Scale, Borg's CR-10 Perceived Exertion scale, and the Swedish Occupational Fatigue Inventory. Sixteen women between the ages of 26 and S7 years (mean 43 years) rotated
OBJECTIVE: The aim of the study was to examine the double locked-in phenomenon at work (i.e., being in a non-preferred occupation and non-preferred work place), and its associations to psychological health, physical health and job satisfaction. METHODS: A total of 136 municipal employees who visited a career coaching center (response rate 59%) participated in the questionnaire study. RESULTS: The
Modelers seeking to help inform decisions about insurance (public or private) coverage of the cost of pharmaceuticals or other health care interventions face various methodological challenges. In this review, which is not meant to be comprehensive, we cover those that in our experience are most vexing. The biggest challenge is getting decision makers to trust the model. This is a major problem bec
The energy loss of projectiles with Z(1) in the range 3-26 has been experimentally measured in the 0.1-0.7 MeV per nucleon energy range in the same Si stopping foil of 105.5 mug cm(-2) thickness using a time of flight-energy (ToF-E) elastic recoil detection analysis (ERDA) setup. A detailed study of the experimental uncertainties for ToF-E and ToF-ToF-E configuration has been made. For ERDA config
