Filtyp
Objectives: To compare personality features of fibromyalgia patients with those of a disease control group with regional pain. Methods: A group of 33 women with fibromyalgia [FMS-group] was compared on the Minnesota Multiphasic Personality Inventory [MMPI] and the Defense Mechanism Technique modified [DMTm] with 31 women [C-group] without this diagnosis who had localized chronic pain in their neck
Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieve
The most precise method of investigating possible space-time variations of the fine-structure constant, alpha equivalent to (1/hc)(e(2)/4 pi epsilon(0)), using high-redshift quasar absorption lines is the many-multiplet (MM) method. For reliable results this method requires very accurate relative laboratory wavelengths for a number of UV resonance transitions from several different ionic species.
SDG - The Raoul Wallenberg Institute of Human Rights and Humanitarian Law Skip to content Search for: Search Button Home About Us Who We Are Our History About Raoul Wallenberg Our Theory of Change Staff Opportunities Annual Reports Whistleblower Our work What we do Multi-Disciplinary Research Higher Education Strategic Advice and Analysis Outreach Evaluation of Programme Work Methods Focus Areas B
https://rwi.lu.se/sdg/ - 2026-06-29
We here suggest and test a new method to obtain stable energies in proteins for charge-neutral reactions by running large quantum mechanical (QM) calculations on structures obtained by combined QM and molecular mechanics (QM/MM) geometry optimisation on several snapshots from molecular dynamics simulations. As a test case, we use a proton transfer between a metal-bound cysteine residue and a secon
Professor Contact details Email: sylvia [dot] schwaag_serger [at] ekh [dot] lu [dot] seOrganisation Department of Economic History Visiting address: Scheelevägen 15 B, Lund Room number: Alfa 1:2083 Service point: 10 WebpageSylvia Schwaag Sergers profile in Lund University research portalOther affiliations Affiliated professor CIRCLE Publications Displaying of publications. Sorted by year, then tit
https://www.lusem.lu.se/sylvia-schwaag-serger - 2026-06-29
Histidine is a key amino-acid residue in proteins with unique properties engendered by its imidazole side chain that can exist in three different states: two different neutral tautomeric forms and a protonated, positively charged one with a pKa value close to physiological pH. Commonly, two or all three states coexist and interchange rapidly, enabling histidine to act as both donor and acceptor of
Background: Combined movement disorders often represent a diagnostic challenge. Dystonia is a movement disorder characterized by genetic and clinical heterogeneity. A recurring p.(Glu303del)-deletion in TOR1A is a well-established cause for DYT-TOR1A (DYT1) dystonia. TOR1A encodes TorsinA, an AAA+ ATPase located in the nuclear envelope. Hemichorea-hemiballismus syndrome can occur after basal gangl
BACKGROUND: Acute ischemic stroke triggers endothelial activation that disrupts vascular integrity and increases hemorrhagic transformation leading to worsened stroke outcomes. rt-PA (recombinant tissue-type plasminogen activator) is an effective treatment; however, its use is limited due to a restricted time window and hemorrhagic transformation risk, which in part may involve activation of MMPs
Transportation noise is a ubiquitous urban exposure. In 2018, the World Health Organization concluded that chronic exposure to road traffic noise is a risk factor for ischemic heart disease. In contrast, they concluded that the quality of evidence for a link to other diseases was very low to moderate. Since then, several studies on the impact of noise on various diseases have been published. Also,
2012-2014 2007-2010 2006-2007 2005 2011 2010 2016 2015 2014 2013 2012 2011 2010 Malmø Art Academy, Post graduate Diploma MFA Fine Art, Sweden Goldsmiths, University of London, Honours BA Fine Art Practice, United Kingdom Central Saint Martins, University of London, Performance design, United Kingdom Bjørn Ignatius Øchenholts Billedkunstskole, Copenhagen, Denmark Film Editor at DFI / The Danish Fil
https://www.khm.lu.se/sites/khm.lu.se/files/2014cv_helenenymann.pdf - 2026-06-30
Microsoft Word - Afrint II Meso 071012 FINAL.doc 1 AFRINT II Final Meso-Level ’Village Diagnostics’ Survey Instrument 2 CONTENTS SECTION I .............................................................................................................................................................................................................................................................. 4 FOR
https://www.keg.lu.se/en/sites/keg.lu.se.en/files/a33.pdf - 2026-06-30
Schema för KURSNAMN 10 p (15 ECTS) VT -2 2003 Course schedule for GEON06, 15 hp (15 ECTS credits) Autumn 2016 6th September 2016, preliminary Course leader: Karl Ljung Teachers: AN = Andreas Nilsson MR = Mats Rundgren ABN = Anne Birgitte Nielsen RM = Raimund Muscheler HA = Helena Alexanderson HL = Hans Linderson JS = Jesper Sjolte YR = Yevhenii Rohozin MCz = Markus Czymzik E-mail to teachers: name
https://www.geology.lu.se/sites/geology.lu.se/files/geon06_schema_ht2_2016-10-12_english.pdf - 2026-06-30
Methods comparison report 2017.pdf IN COLLABORATION WITH GRADUATE SCHOOL Annika Hughes PhD, Graduate School, Faculty of Social Sciences & Christopher Swader (corresponding author) Associate Senior Lecturer, Graduate School & Department of Sociology, Faculty of Social Sciences christopher.swader@soc.lu.se COMPARISON REPORT Lund University Malmö University College Uppsala University University of Go
https://www.graduateschool.sam.lu.se/sites/graduateschool.sam.lu.se/files/methods_comparison_report_2017.pdf - 2026-06-30
Lund 28 February 2017 SASNET Workshop on Online Hate in India and Sweden On February 9-10, SASNET successfully arranged a workshop about Online Hate in India and Sweden. The workshop was held at Media Evolution City in Malmö. The purpose of the workshop was to bring together a diverse range of scholars, journalists, and activists from Sweden and India to reflect upon the similarities and differenc
https://www.sasnet.lu.se/sites/sasnet.lu.se/files/lund_28_february_2017_2.docx - 2026-06-30
To go with HEXTRA worklist: HIV-1 Single Genome Amplification Worksheets Sequencing plate set-up Date Prepared: 31/07/18 Plate ID: S0039 Operator: Sara/Jamirah * Shaded wells with weak bands (red [extremely weak], orange [moderately weak] and yellow [weak] bands). Date collected: Collected by: Signature: Page 1 of 1 image1.emf E18_07 1 2 3 4 5 6 7 8 9 10 11 12 A 271117_A02 050318_E10 050318_F10 03
https://www.virology.lu.se/sites/virology.lu.se/files/s039_310718.docx - 2026-06-30
Microsoft Word - Lund 28 February 2017.docx Lund 28 February 2017 SASNET Workshop on Online Hate in India and Sweden On February 9-10, SASNET successfully arranged a workshop about Online Hate in India and Sweden. The workshop was held at Media Evolution City in Malmö. The purpose of the workshop was to bring together a diverse range of scholars, journalists, and activists from Sweden and Indi
https://www.sasnet.lu.se/sites/sasnet.lu.se/files/lund_28_february_2017.pdf - 2026-06-30
