Filtyp
In this report, we present the results from a systematic benchmarking of four different long neutron guide geometries: elliptic, parabolic, ballistic (piecewise linearly focusing/defocusing), and straight, for various wavelength, divergence restriction, and guide length settings. In this work, we mapped relevant parts of the neutron phase space to show where advanced guide geometries have signific
This is a collection of projects that were written by students participating in our course on Gender in Science and Technology at Lund University. The course is based on a collaboration between the Department of Physics, the Science Faculty and the Department for Gender Studies, the Social Science Faculty. It is something of a record breaker in longevity, since in the autumn of 2014 it will run fo
This study reports on a study from 2008 of overall mobility patterns among older people and the mobility patterns of those in transition from a two person household to a one person household. The purpose of the study was to explore the mobility patterns of those in transition from a two-person household to a one-person household in relation to the overall patterns of mobility of the older people.
This paper presents results of an all-sky search for periodic gravitational waves in the frequency range [50, 1190] Hz and with frequency derivative range of similar to[-20, 1.1] x 10(-10) Hz s(-1) for the fifth LIGO science run (S5). The search uses a noncoherent Hough-transform method to combine the information from coherent searches on time scales of about one day. Because these searches are ve
Shipment consolidation has been advocated by researchers and politicians as a means to reduce cost and improve environmental performance of logistics activities. This paper investigates consolidated transport solutions with a common shipment frequency. When a service provider designs such a solution for its customers, she faces a trade-off: to have the most time-sensitive customers join the consol
We present a theoretical study of the absorption of light in periodic arrays of InP nanowires. The absorption in the array depends strongly on the diameter and the length of the nanowires, as well as the period of the array. Nanowires of a length of just 2 Am are able, after an appropriate choice for the other parameters, to absorb more than 90% of the incident energy of TE and TM polarized light,
Adenovirus-based (Ad) vectors are used widely for experimental gene transfer to the CNS. Ad transduce many cell types including postmitotic neurons. However, their use for, CNS gene transfer is limited due to the host immune response elicited. Furthermore, the extensive distribution of the primary cellular receptor for Ad, the coxsackievirus and adenovirus receptor (CAR), allows adenoviral vectors
Chromosomal aberrations in solid tumors appear in complex patterns. It is important to understand how these patterns develop, the dynamics of the process, the temporal or even causal order between aberrations, and the involved pathways. Here we present network models for chromosomal aberrations and algorithms for training models based on observed data. Our models are generative probabilistic model
Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieve
This paper describes the development and performance of a new rapid amperometric biosensor for fructose monitoring in food analysis. The biosensor is based on the activity of fructose dehydrogenase (FDH) immobilised into a carbon nanotube paste electrode according to two different procedures. The direct wiring of the FDH in a highly original osmium-polymer hydrogel was found to offer a better enzy
How coordination of metal ions modulates protein structures is not only important for elucidating biological function but has also emerged as a key determinant in protein turnover and protein-misfolding diseases. In this study, we show that the coordination of Zn2+ to the ALS-associated enzyme Cu/Zn superoxide dismutase (SOD1) is directly controlled by the protein's folding pathway. Zn2+ first cat
OBJECTIVE: The aim of the study was to examine the double locked-in phenomenon at work (i.e., being in a non-preferred occupation and non-preferred work place), and its associations to psychological health, physical health and job satisfaction. METHODS: A total of 136 municipal employees who visited a career coaching center (response rate 59%) participated in the questionnaire study. RESULTS: The
Modelers seeking to help inform decisions about insurance (public or private) coverage of the cost of pharmaceuticals or other health care interventions face various methodological challenges. In this review, which is not meant to be comprehensive, we cover those that in our experience are most vexing. The biggest challenge is getting decision makers to trust the model. This is a major problem bec
The genomes of Asgard Archaea, a novel archaeal proposed superphylum, share an enriched repertoire of eukaryotic signature genes and thus promise to provide insights into early eukaryote evolution. However, the distribution, metabolisms, cellular structures, and ecology of the members within this superphylum are not well understood. Here we provide a meta-analysis of the environmental distribution
An extraordinarily diverse and well-preserved material, including the remains of 47 insect taxa and 12 taxa of other invertebrates, extracted from the 17th century burial of Bishop Peder Winstrup in Lund Minster, is presented and discussed in terms of the treatment of the body, activities connected with the burial and faunal significance. The invertebrate assemblages include species from gardens,
A combination treatment (CT) of proinsulin and IL-10 orally delivered via genetically modified Lactococcus lactis bacteria combined with low-dose anti-CD3 (aCD3) therapy successfully restores glucose homeostasis in newly diagnosed non-obese diabetic (NOD) mice. Tolerance is accompanied by the accumulation of Foxp3+ regulatory T cells (Tregs) in the pancreas. To test the potential of this therapy o
There is no alternative! Margaret Thatcher once proclaimed in order to defend neoliberalist reforms and – implicitly – the capitalist regime. But if one doesn’t agree with Thatcher’s definition of the situation and her (and her many followers’) subsequent analysis, what viable options does one really have? Is it possible to come up with an empirically grounded alternative to the dominant modes of
Bound by the European Union policy, Poland needs to increase the share of renewable energy by 7,5% by 2010 and 15% by 2020. Biomass was once viewed as the largest potential for expansion of renewable energy in Poland. However, in the light of this thesis work, it appears that recent legislation and the standpoint of the State Forest Company will result in the barely emerging market for biomass fro
Varje år får cirka 50 000 svenskar diagnosen cancer. Mot detta är strålbehandling en vanlig behandlingsmetod och det uppskattas att cirka en tredjedel av alla som får cancer någon gång under sin behandling får strålbehandling. En viktig sak inom strålbehandling är att patienten får den dos som läkaren har ordinerat. Detta är en så vital detalj inom strålbehandling att SSI, Statens StrålskyddsinsIndependent dose calculations in radiotherapy are important as they help assure that the dose given to the patient is the same as the prescribed. The current version of software Radiation Verification Programme, RVP, does not take into account the effects that occur when a beam from a linear accelerator is moved off-axis. The aim with this project was to find a model for these effects, fit the par
Uppsatsen behandlar våld mot kvinnor i nära relationer som grund för flyktingstatus i internationell rätt med svensk rätt som exempel på implementeringen i nationell rätt. Våld mot kvinnor i nära relationer förekommer i alla länder, kulturer och samhällsklasser i världen. Den här typen av våld är den vanligaste orsaken till skador hos kvinnor i näst intill alla länder i världen. Det kan vara mycke
