Filtyp
Small punch (SP) fracture testing with subsequent SEM fractographic analysis was applied to an A 508 Class 3 reactor pressure vessel(RPV) steel, used originally in the NESC-I spinning cylinder experiment, in order to determine the SP ductile-brittle transition temperature of both the base material and the sub-clad heat affected zone. In addition to the evaluation of the SP transition temperature,
In the history of English language research on computerised corpora, the year 1977 marks an important event with the birth of ICAME - the International Computer Archive of Modern and Medieval English - which set off international co-operation on a large scale. The use of computer corpora, from being a fringe activity, has become a mainstream methodology. Yet there was corpus life also before ICAME
The outdoor environment is deteriorating in many tropical cities due to rapid urbanization. This leads to a number of problems related to health and well-being of humans and also negatively affects social and commercial outdoor activities. The creation of thermally comfortable microclimates in urban environments is therefore very important. This paper discusses the influence of street-canyon geome
BACKGROUND: The size of myocardial infarction (MI) is of significance for the prognosis. Selvester scores might be valuable for this estimation. OBJECTIVE: To compare the differences in Selvester scores for chronic MI provided from standard and EASI-derived 12-lead electrocardiograms (ECGs) and to compare these scores to the MI size measured by delayed-enhancement magnetic resonance imaging (DE-MR
We present a web-based method for mapping various relations between agents that have been involved in an emergency response operation. The method is based on combining a web-questionnaire with telephone interviews and it provides an efficient way of collecting large amount of information concerning the agents. By using the resulting network of agents it is possible to perform various network analy
Ag/alumina catalysts with different silver contents for octane-SCR were prepared by impregnation and incipient wetness methods. Activity tests revealed that the decisive factor for high activity is not only a high dispersion of silver, but also the ability of the system to redisperse clustered silver. Determination of dispersion by TEM/HAADF and O-2-chemisorption experiments resulted in values clo
Incorporation of the antimicrobial peptide LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieve
The partitioning of P among major chemical forms was studied in 110 non-fertilized, semi-natural grassland soils of southeastern Sweden, comprising a wide range of soil acidity and other chemical properties. The P fractions bound to Ca and Fe were closely related to soil acidity, expressed as pH-KCl, especially when calculated as % of the total pool of mineral P. The relationship was inversely lin
Müller cells are essential in creating and maintaining intricate neuroretinal architecture. The functions of this important glial cell are not limited to mere support of the retinal neurons, but also include interaction in synaptic transmission and activation in response to retinal insult. In this study, we have examined Müller cell morphology and degree of activation in embryonic full-thickness r
The study examines very Young children with the aim of identifying precursors of developmental problems during, the first 7 months of age. Information front screening, and observations in the birth clinic, in the first level of health care. and from parents was collected on five different occasions. The information that Was included concerning the child and family was defined as either optimal or
For 10 consecutive winters, measurements were carried out in Lake Vendyurskoe, Karelia, Russia. The aim of these measurements was to investigate some of the physical processes in this small shallow lake during its ice-covered period. Detailed measurements of ice thickness and condition, snow thickness, water temperature, salt content, and currents were developed into a database. Within this databa
The most precise method of investigating possible space-time variations of the fine-structure constant, alpha equivalent to (1/hc)(e(2)/4 pi epsilon(0)), using high-redshift quasar absorption lines is the many-multiplet (MM) method. For reliable results this method requires very accurate relative laboratory wavelengths for a number of UV resonance transitions from several different ionic species.
We examined the association between fruits and vegetables and risk of renal cell carcinoma (RCC) in the European Prospective Investigation into Cancer and Nutrition (EPIC). Dietary intake data and complete follow-up information on cancer incidence were available for 375,851 participants recruited in EPIC centers of 8 countries. During an average follow-up of 6.2 years, 306 incident cases of RCC we
During very long self-rating sessions there is a risk that respondents will be tired and/or lose interest. Is this a concern for users of long personality inventories, such that the reliability becomes threatened in the latter half when respondents have made hundreds of personality self-ratings? Two thousand three hundred and fifty two volunteers completed long (≈ 500 items) personality inventorie
BIRDS THAT SPEND the winter in a harsh and cold climate face a suite of challenges that require optimization of energy expenditure and energy intake. Some birds roost communally, which can increase energy savings during cold winter nights. However, this behaviour is almost completely absent in chickadees, tits, and titmice (Paridae) as there are very few accounts in the literature of parids roosti
Histidine is a key amino-acid residue in proteins with unique properties engendered by its imidazole side chain that can exist in three different states: two different neutral tautomeric forms and a protonated, positively charged one with a pKa value close to physiological pH. Commonly, two or all three states coexist and interchange rapidly, enabling histidine to act as both donor and acceptor of
Temakurs på avancerad nivå (7,5 hp) 1 LUNDS UNIVERSITET ht 2011 HISTORISKA INSTITUTIONEN HIS N31 Staten blir till. Statsbildning och statssystem i Europa, särskilt under tidigmodern tid Temakurs avancerad nivå (7,5 hp) Varför finns det stater? Frågan kan verka konstig. Få saker verkar så självklara för oss som att jordytan är indelad med skarpa gränser mellan områden med olika lagar, regler och of
https://www.historiska.lu.se/media/utbildning/dokument/kurser/HISN31/20112/SchemaHISN31.pdf - 2026-07-10
Millimeter wave pulsed radar has found many applications, among them hand gesture sensing, which this work has as purpose. This application has already shown good potential, [1], and here in this work robustness aspects are taken into account. A classification task was defined, where distinction should be made between five different small hand gestures, recorded by 18 people in total. The classifi
