Sökresultat

Background: We evaluated the association of total and free forms of serum human kallikrein 2 (hK2) and prostate-specific antigen (PSA) with prostate cancers of unfavorable prognosis. Methods: We retrospectively measured total PSA (tPSA), free PSA (fPSA), and total hK2 (thK2) in preoperative serum samples from 867 men [and assessed free hK2 (fhK2) measured in 577 of these men] treated with radical

Background: Late health consequences of treatment for childhood leukemia are well documented. Although individuals with Down syndrome (DS) have a substantially increased risk of leukemia, information on late effects in this group is almost nonexistent. The aim of this study was to evaluate the mortality and morbidity among 5-year leukemia survivors with DS. Procedure: We compared 5-year leukemia s

Objectives: Celiac disease (CD) is associated with thyroid autoimmunity and other autoimmune diseases. Data are, however, lacking regarding the relationship between thyroid autoimmunity and thyroid function, especially in regard to CD. Our aim was to investigate the impact of thyroid autoimmunity on thyroid function in 12-year-old children with CD compared to their healthy peers. Methods: A case-r

The plasma proteins alpha1-microglobulin (alpha1-m) and bikunin are synthesized in the liver as a common precursor which is cleaved just before secretion. Half of plasma alpha1-m is covalently linked to fibronectin and alpha1-inhibitor-3, and more than 95% of bikunin is part of pre-alpha-inhibitor, inter-alpha-inhibitor and related large molecules. Both alpha1-m and bikunin have been shown to be i

Background and aim: Whether long-term oxygen therapy (LTOT) improves survival in interstitial lung disease (ILD) is unclear. A recent study reported similar survival in ILD patients with severe hypoxemia on LTOT vs. moderate hypoxemia without LTOT, and proposed that LTOT could be indicated in ILD already at moderate hypoxemia. The aim of this study was to compare survival by severity of hypoxemia

Demand for plant products has increased in recent years. To produce a vegetable yogurt with good taste and with the right consistency is problematic without the milk protein casein. Product development of a vegetable yoghurt type product was made. Collaboration with Veg of Lund AB was performed on their currently existing products My Foodie blueberries, raspberry and sea buckthorn with a focus on

The influence of three organic compounds and bakers' dry yeast on growth of external mycelium and phosphorus uptake of the arbuscular mycorrhizal fungus Glomus intraradices Schenck and Smith (BEG 87) was examined. Two experiments were carried out in compartmentalized growth systems with root-free sand or soil compartments. The sand and soil in the root-free compartments were left untreated or unif

Till följd av höga växthusgasutsläpp har klimatförändringarnas konsekvenser fastställts av FNs klimatpanel IPCC som ett omfattande hot mot både människans och planetens välbefinnande. För att Parisavtalets mål om att begränsa den globala uppvärmningen till 1,5 grader celcius ska uppnås, krävs snabba och resoluta utsläppsminskningar utan motstycke. Basindustrin, däribland stålindustrin som står för

The Department of Service Studies is part of several interdisciplinary research centers and networks. What characterizes these platforms is that they work as gathering points for researchers and practitioners, stimulating research and dialogue across boundaries – both within the academy and in the surrounding society. Centre for retail researchAn interdisciplinary centre of excellence in retail re

https://www.ses.lu.se/en/collaborate/research-centres-and-networks - 2026-05-05

Aromatic amino acids play an important role in ultraviolet (UV)-induced photochemical reactions in proteins. In this work, we aim at gaining insight into the photochemical reactions induced by near-UV light excitation of aromatic residues that lead to breakage of disulfide bridges in our model enzyme, Fusarium solani pisi cutinase, a lipolytic enzyme. With this purpose, we acquired transient absor

Popular Abstract in Swedish Vid extern strålbehandling används en s.k. linjäraccelerator för att producera och leverera den önskade strålningen till cancertumörer. I linjäracceleratorn accelereras elektroner till nära ljusets hastighet och styrs sedan mot en metalplatta där de bromsas upp och genererar bromsstrålningsfotoner (högenergetisk röntgenstrålning). Intensiteten av den strålning som sändsThe aim of this work was to investigate the dosimetric effects of removing the flattening filter from conventional C-arm medical linear accelerators. In conventional linear accelerators used for radiotherapy, a flattening filter is positioned in the beam line to provide a uniform lateral dose profile at a specified depth in water. However, for some radiotherapy treatments, a uniform lateral dose p

Background The aim of this study was to investigate gene transfer to human umbilical cord blood (CB) CD34(+)/CD38(low) and NOD/SCID repopulating cells using oncoretroviral vectors and to compare the transduction efficiency using three different viral envelopes. Methods CB cells were transduced on Retronectin using an MSCV-based vector with the gene for GFP (MGIN), which was packaged into three dif

Preeclampsia (PE), is a pregnancy related condition afflicting 3-8% of all pregnancies and a main cause of maternal and infant morbidity and mortality. It is thought to originate from a malfunctioning placental that eventually leads to damage to the maternal endothelium, which in turn gives rise to hypertension and organ dysfunction. Oxidative stress holds a central role in the development, progre

Objectives: As mortality of septic shock decreases, new therapies focus on improving short-term organ dysfunction. However, it is not known whether short-term organ dysfunction is associated with long-term mortality of septic shock. Design: Retrospective single-center. Setting: Mixed medical-surgical ICU. Patients: One thousand three hundred and thirty-one patients with septic shock were included

ConclusionsPaper I: Complications in Extracorporeal Shock Wave Lithotripsy (ESWL): A cohort study, conclusion: We conclude that there are few complications to modern ESWL treatment. 1 Hz should be used to reduce complications (p=0.025). As there is no indication that 1Hz is less effective than 1.5 Hz, this strongly implies that 1 Hz should normally be the frequency used.Success rate with ESWL alon

In this thesis, the electronic structure and optical properties of semiconductor nanostructures are studied theoretically. Three types of nanostructures have been studied, silicon nanocrystals, free-standing III-V nanowires and free-standing GaAs/AlGaAs nanowire superlattices. The calculations have been carried out using an atomistic, empirical tight-binding approach. Silicon nanocrystals have at

Platform for Strategic Work | Lund University 2026–2027 Platform for Strategic Work LUND UNIVERSITY | 2026–2027 PLATFORM FOR STRATEGIC WORK | 2026–2027 2 Greater international impact, building upon strong local and regional engagement PLATFORM FOR STRATEGIC WORK 2026–2027 The world around us is significantly more unpredict­ able and changeable than before and the conditions are more complex. The f

https://www.staff.lu.se/sites/staff.lu.se/files/2026-04/Platform%20for%20Strategic%20Work%202026%E2%80%932027.pdf - 2026-05-05

The performance of poly(4-methyl-2-pentyne) (PMP)/silica nanocomposites was studied for membranes with a filler content between 10 and 40 wt%. An increase in permeability and a constant vapor selectivity were measured with increasing filler content. The constant selectivity was in contrast to earlier published results for silica filled poly(l-trimethylsilyl-l-propyne) (PTSMP) membranes. Therefore,

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka